PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_070CE3D50.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HSF
Protein Properties Length: 122aa    MW: 13821.1 Da    PI: 8.4983
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_070CE3D50.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind58.61.7e-181431860
                           TSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
           HSF_DNA-bind 18 liswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                           +isw   gnsfvv+++++fa++vLp+ Fkh+nf+SFvRQLn+Y
  Traes_2DS_070CE3D50.1  1 VISWGPAGNSFVVWNPSTFARDVLPHNFKHNNFSSFVRQLNTY 43
                           69****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF467857.62E-16143IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.3E-15143IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.102.9E-18143IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004158.9E-6162IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
VISWGPAGNS FVVWNPSTFA RDVLPHNFKH NNFSSFVRQL NTYVRIISLP SPLFFLSFAI  60
RRWIIHAAVL CSGDALFPLG IWHSVSDALF SFCSFWFLLL YSAQICCVYI LCTTSLAYFV  120
SG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM4460281e-58HM446028.1 Hordeum vulgare subsp. vulgare heat shock factor A3 (HsfA3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5C2V12e-83W5C2V1_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2786422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.11e-19heat shock transcription factor A3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]